FishOrthoDB
Ens76 (including eel) Database of bony fish orthologs. All list
Query Word Search

(gene name or protein/gene ID)
Example: RAG; ENSP00000330341; ENSG00000167588; ENSDARP00000108469

BLASTP Search Against Human Transcriptome

(Amino acid sequence)
Example:
>PPP3CC_H
GMSPEITSLDDIRKLDRFTEPPAFGPVCDLLWSDPSEDYGNEKTLEHYT
HNTVRGCSYFYSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQATG
FPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFM
DVFTWSLPFVGEKVTEMLVNVLNICSDDELISDDEAEGSTTVRKEIIRN
KIRAIGKMARVFSILRQESESVLTLKGLTPTGTLPLGVLSGGKQTIETA
TVEAVEAREAIRGFSLQHKIRSFEEARGLDRINERMPPRKDSIHAGGPM
KSVTSAHSHAAHRSDQGKKAHS

Ver.17 spp. jun.inoueAToist.jp SI